We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Trump's '51st state' comment mocked in 'legendary' Canada ad mark carneydonald trumpcanadamike myersnewsamericamark carney6h1742730152
GTA 6 LIVE: Trailer 2 release date hiding in plain sight 'all along' gta 6rockstar gamesgrand theft autovideo gamesgamestake-twogta 6Mar 20, 20251742458049
Andrew Tate hits out at Ashley Walters over Adolescence in fiery post andrew tateandrew tatenetflixadolescencetelevisionMar 21, 2025
Donald Trump and Conor McGregor's White House meeting explained donald trumpconor mcgregoroval officewhite housedonald trumpMar 18, 2025
Donald Trump voter 'concerned' for wife after she was detained by ICE donald trumpimmigrationdeportationdonald trumpMar 20, 2025
I was a nail-biter for 25 years - this is what stopped me for good beautynailsmanicurehealthmental healthbeautyJan 30, 2025
