We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Trump drops major hint he'll run for third term - but there's one thing stopping him donald trumpuspresidentus presidentdonald trump2h1740154121
GTA 6 LIVE: Game news 'not far' after GTA 5 on PC gets free upgrade gta 6rockstar gamesgrand theft autovideo gamesgamestake-twogta 67h1740135288
Discovery where 'Moses parted Red Sea' could change what we know earthsciencered seamosesdeep seaseadiscoverydeath poolsbrine poolsgulf of aqabaearth6h
Did this social media post 'predict' Elon Musk's '13th child?' elon muskashley st clairbabyus politicsdogepoliticselon muskFeb 15, 2025
Emotional TikTok tributes flood in for the anglerfish and her last moments anglerfishtiktoktributestenerifeoceanfishtheoriestiktok trendanglerfishFeb 14, 2025
Trump 'babysitting' Musk's son becomes an instant meme elon muskdonald trumpoval officeus politicsgrimespoliticsusaelon muskFeb 12, 2025
Where is Netflix's Apple Cider Vinegar muse Belle Gibson now? netflixtvtv showapple cider vinegarnetflix1h
I was a nail-biter for 25 years - this is what stopped me for good beautynailsmanicurehealthmental healthbeautyJan 30, 2025
