We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Donald Trump's latest physical results have been revealed - and the internet has a lot to say Donald Trumpus politicsnewsdonald trumpDonald Trump23h1744621565
GTA 6 LIVE: Game release to end 'post-pandemic industry depression' gta 6rockstar gamesgrand theft autovideo gamesgamestake-twogta 61h1744701669
Handful of countries exempt from Trump's tariffs - people aren't happy tariffsdonald trumptrade wartariffsApr 03, 2025
Epstein victim Virginia Giuffre sent well-wishes with 'days to live' virginia giuffrejeffrey epsteinprince andrewvirginia giuffreApr 01, 2025
First look at comedy western Eddington movie trailer eddington trailerfirst looknew trailerari astermidsommarjoaquin phoenixpedro pascalemma stoneeddington trailer16h
Katy Perry kisses ground on returns from space on Blue Origin craft katy perryspaceblue originjeff bezosgayle kingall female crewastronautskaty perry17h
I was a nail-biter for 25 years - this is what stopped me for good beautynailsmanicurehealthmental healthbeautyJan 30, 2025
