Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Dua Lipa and Simone Biles have reinvented the 2024 word of the year word of the yeardua lipasimone bilesword of the year14h1732114059
Elon Musk branded 'First Lady Elonia' for 'odd' Trump relationship elon muskdonald trumpusfirst ladyus electionus election 2024elon muskNov 12, 20241731420328
GTA 6: Live updates as 'screenshot leaks' appear online gta 6gamesgrand theft autorockstar gamesvideo gamesgta 619h
Axed 2016 Britney Spears interview about conservatorship resurfaces britney spearsconservatorshipthe jonathan ross showbritney spearsNov 11, 2024
Zoo ‘in awe’ of Boki the brown bear’s progress after pioneering brain surgery AnimalsAnimalsBearBrain surgeryKentNov 20, 2024
Scientists record 'lonely' bottlenose dolphin talking to himself dolphinbottlenose dolphinsdolphinNov 19, 2024
John Stamos criticised for wearing a bald cap in cancer 'solidarity' john stamosdave couliercancerjohn stamosNov 19, 2024
Kim Kardashian asks Tesla robot to 'blow a kiss' in bizarre video kim kardashianteslarobotkim kardashianNov 19, 2024
Early rewilding site secured for nature after ‘outpouring’ of public support EnvironmentNov 14, 2024
