Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Flat Earther spends $37 to prove conspiracy - proves himself wrong flat earthflat earthersantarcticaflat earth11h1734688682
GTA 6 LIVE: Rockstar Games employees 'tease' news with merch posts gta 6gamesgrand theft autorockstar gamesvideo gamesgta 610h1734690719
Deadliest day in history killed more people than two atomic bombs historyearthquakechinanatural disasterdisasterhistoryDec 08, 2024
Nintendo Switch 2: Everything we know so far switch 2nintendonintendo switchvideo gamesgamesswitch 24h
Luigi Mangione and Diddy's lawyers are a married couple luigi mangionediddylawyerluigi mangioneDec 17, 2024
Who will be the protagonist of Red Dead Redemption 3? red dead redemption 3gamesredditrockstar gamessocial mediavideo gamesred dead redemption 3Dec 16, 2024
Nintendo Switch 2: Everything we know so far switch 2nintendonintendo switchvideo gamesgamesswitch 2Dec 08, 2024
James Gunn's Superman has split fans because of colours in the trailer supermanjames gunndcdcusupermanDec 19, 2024
