We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Kid Rock derails interview by 'flirting' with BBC News presenter kid rockcelebritydonald trumpinauguration dayus newsbbckid rock15m1737392195
GTA 6 LIVE: $80 or $100 price tag analysis shut down by insider gta 6gamesgrand theft autorockstar gamesvideo gamesgta 68h1737361378
American content creators mocked for giving dramatic TikTok goodbyes tiktoktiktok bancontent creatorsusadonald trumpmemestrendstiktok3h
People never realised the moon looks different depending where you are moonsciencediscoverysocial mediaviral videomoon6h
US is the country most vulnerable to air pollution anywhere in world air pollutionusclimate crisisscienceglobal warmingclimate changeair pollution19m
A missing woman investigation has been solved after 52 years missing personuk newsnewsmissingmissing personhannah kobayashiJan 02, 2025
Everything brands are offering to brighten your Blue Monday blue mondayjanuarydepressionmental healthdealfreefoodblue monday6h
Did Trump admit Musk rigged US election? Conspiracy theory explained donald trumpelon muskconspiracy theorysocial mediaus politicsdonald trump20m
