We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
This common millennial texting habit is giving Gen Z the ick gen zmillennialstextingphonesocial mediagen z12h
GTA 6 LIVE: Hope for 'scrapped' GTA 5 feature in new game gta 6rockstar gamesvideo gamesgamesgrand theft autogta 6Aug 25, 2025
Child breaks down after learning Donald Trump is a real person donald trumptiktoktrumppresidentusdonald trump14h
Creamfields adds gym and 5k runs to festival - and people are divided festivalsgen zhealthmusicmusic festivalwellnessfestivals9h
Governor has savage one-word response to Trump's wild claim about him donald trumpwes mooregovernormarylanddonald trump12h
Donald Trump Jr's South Park tweet might come back to haunt his dad trumpdonald trumpsouth parkwhite houseparodysitcomparamountsocial mediatrumpAug 24, 2025
Ancient DNA discovery just rewrote the course of human history dnahistoryhumansalaskaamericaearthancestrygenesdnaAug 22, 2025
Outrage over ‘Trump gamer tax’ - everything you need to know playstationplaystation 5ps5gamingtariffsdonald trumpplaystationAug 21, 2025
