We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
Trump could get Nobel Peace Prize as winner makes bizarre suggestion nobel peace prizedonald trumpmaria corina machadovenezuelanobel peace prize4h
GTA 6 LIVE: Insider's release date verdict has not convinced fans gta 6grand theft autorockstar gamesvideo gamesgamesgta 67h
Jimmy Kimmel spears Donald Trump by taking cognitive test on talk show donald trumpcognitivecognitive testjimmy kimmeljimmy kimmell livemockmockingtestdonald trump5h
Peruvian shaman makes chilling prediction about Donald Trump for 2026 donald trump2026ceremonylimanew yearperuperuvianpredictionsshamantraditionaldonald trump1h
Trump accused of ‘vandalism’ over 'downright weird' name change Donald Trumpkennedy centerkaroline leavittnewsjohn f kennedydepartment of wardonald trumpDonald TrumpDec 20, 2025
Nike tracksuit worn by Venezuela’s Nicolas Maduro goes viral newsvenezuelatrumpdonald trumpnicolas madurofashionnikenews4h
Ashley Tisdale on walking away from toxic friendships relationshipsfriendshipashley tisdalerelationships4h
Emily in Paris season 5: Every outfit inside Emily's $37,000 wardrobe emily in parislily collinsnetflixtvtv showemily in paris1h
