We 'ingest and inhale microplastics' constantly - but there's hope microplasticsclimateclimate changeplastic wasteplasticenvironmentuniversity of portsmouthnewsmicroplasticsJan 16, 2025
Plastic chemicals contributing to thousands of global deaths newshealthenvironmentplasticplastic wastenewsDec 17, 2024
Microplastics might even be influencing the weather, scientists say microplasticsplasticweatherpennsylvaniaatmospherecloudsmicroplasticsNov 12, 2024
Natural fibres in wet wipes could be worse for the planet than plastic pollutionplasticeco-friendlypollutionNov 07, 2024
Scientists discover rare protein with unique plastic-eating properties bacteriaproteinplasticbacteriaFeb 24, 2024
Fruit roll-ups warn TikTokers against dangerous plastic eating trend tiktokplasticussnackstiktokMar 23, 2023
A campaign group are actually arguing that ocean plastic is ‘good’ ocean plasticanimalsecosystemoceansplasticenvironmentcop26wasteocean plasticNov 07, 2021
Scientists find plastic at bottom of one of deepest ocean trenches earthpollutionplasticvictor vescovoscientistsearthMay 31, 2021
A tiny caterpillar could be the solution to plastic pollution pollutionenvironmentplasticpollutionMar 07, 2020
Jason Momoa apologises for Mueller report drama beardplasticmueller reportrecyclingjason momoaellen degeneresbeardMay 09, 2019
This dead whale was found with 40kg of plastic in its stomach plasticenvironmentscienceplasticMar 18, 2019
‘Skedaddle… it means skedaddle’: 9 of Trump’s best language blunders Donald Trumplanguageenglishnewscovfefedictionarydonald trumpDonald Trump4h
The 20 most stupid things Donald Trump has ever said donald trumptrumpus politicsrepublicankamala harrisdonald trumpJul 08, 2025
GTA 6 LIVE: Game allowing Sony to focus on PS6 right now says expert gta 6gamesgrand theft autorockstar gamesvideo gamesgta 6Jul 08, 2025
'Call off Glasto, it's peaked': The 8 best flags at Glastonbury 2025 glastonburyglastonbury 2025flagshumourcomedymusicglastonburyJun 27, 2025
PS6: Sony putting 'side bets' on handheld console says gaming expert ps6gamesplaystationsonyvideo gamesps6Jul 09, 2025
Trump slammed for praising Liberian leader's English for one reason donald trumptrumpliberiapresidentwhite housedonald trumpJul 10, 2025
Planet Earth may have once had a Saturn-like ring say scientists spaceearthsaturnringsscientiststheoryspaceJul 08, 2025
